Protein Info for BWI76_RS27960 in Klebsiella michiganensis M5al

Annotation: alcohol dehydrogenase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 30 to 133 (104 residues), 47.5 bits, E=2.2e-16
• PF00107: ADH_zinc_N
  • amino acids 177 to 301 (125 residues), 102.8 bits, E=2.1e-33
• PF13602: ADH_zinc_N_2
  • amino acids 209 to 338 (130 residues), 53.2 bits, E=9.5e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to enc:ECL_00006)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• (S)-propane-1,2-diol degradation (5/5 steps found)
• ethanolamine utilization (5/5 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• pyruvate fermentation to ethanol II (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-methionine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

See A0A285AVA9 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BWI76_RS27960 alcohol dehydrogenase protein (Klebsiella michiganensis M5al)
MTETMQRWSMNALGRENLKLTQAPVPQPGPGEVRVRVNAVALNYRDKMVIEGSMPIALSF
PFTPASDMAGVVESTGEGVTRFKPGARVISTFFPEWIDGRPTADARTLPYKTTGGYFQGM
LAEYVIVNENGLVAAPETLDDAEASTLPCAGLTAWFALVERGHLRAGQSVLVQGTGGVAI
FALQIAKAQGAEVFVTSGSDEKLARAKQLGADYGINRLKGDWAEGIYELTNDRGIDHIIE
TVGGENLRHSLRAVAVHGRISVIGVLAGSEISLSAGELLLKSPVIQGIGVGHRRALEDFV
RAVDVTGLKPVIEHRYRFNQLEQALEHLDRGAFGKIVLTHE