Protein Info for BWI76_RS27935 in Klebsiella michiganensis M5al

Annotation: galactonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF02746: MR_MLE_N" amino acids 15 to 107 (93 residues), 105.4 bits, see alignment E=2.1e-34 PF13378: MR_MLE_C" amino acids 138 to 355 (218 residues), 210.6 bits, see alignment E=2.4e-66

Best Hits

Swiss-Prot: 95% identical to DGOD_KLEP7: D-galactonate dehydratase (dgoD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_06985)

MetaCyc: 93% identical to D-galactonate dehydratase (Escherichia coli K-12 substr. MG1655)
Galactonate dehydratase. [EC: 4.2.1.140, 4.2.1.6]

Predicted SEED Role

"Galactonate dehydratase (EC 4.2.1.6)" in subsystem D-galactonate catabolism (EC 4.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.140 or 4.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVA3 at UniProt or InterPro

Protein Sequence (382 amino acids)

>BWI76_RS27935 galactonate dehydratase (Klebsiella michiganensis M5al)
MKITKLTTYRLPPRWMFLKIDTDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPARI
NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
GGDRPAEVIDGIKKLRGIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNEIEF
GLDFHGRVSAPMAKVLIKELEQYRPLFIEEPVLAEQAEYYPRLAAQTSIPIAAGERMFSR
FEFKRVLEAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHVD
FVSYNAVFQEQSMGIHYNKGAELLDFVKNKEDFNMEGGFFKPLMKPGLGVEIDEARVMEL
SQNAPDWRNPLWRLEDGVVAEW