Protein Info for BWI76_RS27930 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 17 to 31 (15 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 382 (361 residues), 163.6 bits, see alignment E=3.2e-52

Best Hits

KEGG orthology group: None (inferred from 86% identity to kpe:KPK_2037)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AV86 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BWI76_RS27930 MFS transporter (Klebsiella michiganensis M5al)
MSIELYTSTLKKLNSKIIPFVIICYFVANLDKTNISIAALQMNADLGLTASMYGLGVGMF
YISYIIFEIPSNVIMTRIGARIWIARIMITWGIVSAGMSLVHTPTQLYVMRFLLGMAEAG
FTPGIIYYISCWFPKSNRARAMSFFYMGSVLASIIGLPISGFILNMHGIADIAGWRWLFA
IEGIPAIILGVMVLWLLPSSPEKAHWLTGSEKEWLVSQLEEDNRNVMVNKNHSWLSALKN
KVVLLLSLVWFLQAFGSIGITLFLPLILKSIASEQSNFVISLLSAVPFIFACLFMYLNGR
HSDLTKERSLHMGLPLILAGVSLGVAIYSDNLLISYILLVLTVGFNFALTPVFWAVTTEK
LAGVAAAASIAFINTIANFVGLGLPPVLGKIKDVTHSYHYGLLIVAIALVLGGIIGIAVS
RTGKDTSLKHSAHSSL