Protein Info for BWI76_RS27895 in Klebsiella michiganensis M5al

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 20 (1 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 121 to 137 (17 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 400 to 424 (25 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 465 to 485 (21 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details amino acids 529 to 552 (24 residues), see Phobius details PF06826: Asp-Al_Ex" amino acids 11 to 179 (169 residues), 143.8 bits, see alignment E=4.8e-46 amino acids 374 to 546 (173 residues), 157.9 bits, see alignment E=2.2e-50 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 16 to 166 (151 residues), 128.4 bits, see alignment E=9.8e-42 amino acids 379 to 533 (155 residues), 163.4 bits, see alignment E=1.7e-52 PF02080: TrkA_C" amino acids 212 to 271 (60 residues), 27 bits, see alignment 3.3e-10 amino acids 291 to 360 (70 residues), 40.2 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 94% identical to Y4047_KLEP7: Putative transport protein KPN78578_40470 (KPN78578_40470) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_06955)

Predicted SEED Role

"Mediator of hyperadherence YidE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVE0 at UniProt or InterPro

Protein Sequence (553 amino acids)

>BWI76_RS27895 transporter (Klebsiella michiganensis M5al)
MSDIALTVSVLALVAVVGLWIGNVKVRGVGFGIGGVLFGGIIVGHFVDQAGITLSSPMLH
FIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAILIVILGGLVTAVLHKLFDIPLP
VVLGIFSGAVTNTPALGAGQQILRDLGVPLDTVDQMGMSYAMAYPFGICGILLTMWLVRL
FFRINVEKEAQQFDEISGNGHAHLQTINVRVENPNLNNMAIQDVPMLNSDKLICSRLKRE
EMLMVPAPNTLIQLGDLLHLVGRPEDLHNAQLVIGKEVSTSLSTRGTDLKVERVVVTNEK
VLGKRIRDLHFKQRYDVVISRLNRAGVELVASSHASLQFGDILNLVGRPEAIDAVAAELG
NAQQKLQQVQMLPVFIGIGLGVLLGSIPLFIPGFPAALKLGLAGGPLIMALILGRIGSIG
KLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVATLIEGDGMSWIVYGIFITAIPLLA
VGILARMLAKMNYLTLCGMLAGSMTDPPALAFANNLHATSGAAALSYATVYPLVMFLRII
TPQLLAVLFWGIG