Protein Info for BWI76_RS27885 in Klebsiella michiganensis M5al

Annotation: PTS alpha-glucoside transporter subunit IICB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 329 to 370 (42 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details TIGR02005: PTS system, alpha-glucoside-specific IIBC component" amino acids 2 to 524 (523 residues), 894.3 bits, see alignment E=3.1e-273 PF02378: PTS_EIIC" amino acids 10 to 346 (337 residues), 233.2 bits, see alignment E=4.1e-73 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 60 to 358 (299 residues), 296.5 bits, see alignment E=3.1e-92 TIGR00826: PTS system, glucose-like IIB component" amino acids 409 to 510 (102 residues), 91.8 bits, see alignment E=4e-30 PF00367: PTS_EIIB" amino acids 454 to 483 (30 residues), 43.4 bits, see alignment (E = 1.8e-15)

Best Hits

Swiss-Prot: 96% identical to PTUCB_KLEPN: PTS system alpha-glucoside-specific EIICB component (aglA) from Klebsiella pneumoniae

KEGG orthology group: K02749, PTS system, arbutin-like IIB component [EC: 2.7.1.69] K02750, PTS system, arbutin-like IIC component (inferred from 96% identity to kpu:KP1_5463)

Predicted SEED Role

"PTS system, maltose and glucose-specific IIC component (EC 2.7.1.69) / PTS system, maltose and glucose-specific IIB component (EC 2.7.1.69)" in subsystem Maltose and Maltodextrin Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AV79 at UniProt or InterPro

Protein Sequence (540 amino acids)

>BWI76_RS27885 PTS alpha-glucoside transporter subunit IICB (Klebsiella michiganensis M5al)
MLSQIQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPMFVGEALTAPDSLFAQIVHIIEEGG
WTVFRNMPLIFAVGLPIGLAKQAQGRACLAVLVSFLTWNYFINAMGMTWGHFFGVDFSVE
PTAGSGLTMMAGIKTLDTSIIGAIVISGLVTALHNRYFDKPLPVFLGIFQGSSFVVIVAF
LAMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYIFLERILIPTGLHHFVYGPFI
FGPAVVEGGIQVYWAQHLQAFSQSTEALKTLFPEGGFALHGNSKVFGSVGIALALYFTAA
PENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFAVHAVLAATMATVMYICGVVG
NFGGGLLDQFLPQNWIPMFHNHASMMFIQIGVGVCFTALYFVIFRTLILRLNLKTPGREE
SEIKLYSKADYQAARGKTSAAGAADTKLGQAAGFLQALGGAGNIESINNCATRLRIALVD
MAKTQSDDVFKALGAHGVVRRGNGIQVIVGLHVPQVRDQLETLMKDSLQTEQTTMTEAVS