Protein Info for BWI76_RS27750 in Klebsiella michiganensis M5al

Annotation: PTS lactose/cellobiose family transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 16 to 426 (411 residues), 370.4 bits, see alignment E=6.5e-115 PF02378: PTS_EIIC" amino acids 33 to 352 (320 residues), 188.1 bits, see alignment E=1.1e-59

Best Hits

KEGG orthology group: None (inferred from 97% identity to eae:EAE_06800)

Predicted SEED Role

"PTS system, cellobiose-specific IIC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBX2 at UniProt or InterPro

Protein Sequence (441 amino acids)

>BWI76_RS27750 PTS lactose/cellobiose family transporter subunit IIC (Klebsiella michiganensis M5al)
MSSLYQSMIAVIEQSITPLAGRLGQQKYVIAIRDGFTAALPFMIIGSFMLVFIFPPFSPD
TTNGFARGWLDFSQQYREQLMLPFNLSMGVMTFFISVGIGASLGRQFQLDPVMSGLLAFM
AFLLVAAPYADGKISTQYLSGQGIFTALITAIYSTRVYAWLKQNNITIRLPKEVPTGVAR
SFEILIPVLVVIATLHPLNLFIEAQTGMILPQAIMHLLEPLVSASDSLPAILLSVLMCQI
FWFAGIHGSLIVTGIMNPFWMANLSANQAALAAGAALPHVYLQGFWDHYLLIGGVGSTLP
LAFLLLRSRVTHLRTIGKMGIVPSFFNINEPILFGAPIIMNPMMFIPFVFVPMINAVLAY
GATRLGWLSQVVSLTPWTTPAPIGASWAANWTLSPVVMCLICMVMSALIYLPFLRAYERS
LMKTEVEKAKAAVPVAETVSQ