Protein Info for BWI76_RS27720 in Klebsiella michiganensis M5al

Annotation: carboxylate/amino acid/amine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 237 (27 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 292 (17 residues), see Phobius details PF00892: EamA" amino acids 6 to 144 (139 residues), 69.4 bits, see alignment E=1.9e-23 amino acids 158 to 290 (133 residues), 75.5 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 84% identical to YICL_ECOLI: Uncharacterized inner membrane transporter YicL (yicL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to kpe:KPK_0049)

Predicted SEED Role

"FIG00732287: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BC16 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BWI76_RS27720 carboxylate/amino acid/amine transporter (Klebsiella michiganensis M5al)
MGSSKKGMLNVLIAAVLWGSSGVCAQYIMQQSQMSSPFLTMTRLLFAGLILLMLSFFHGD
KIFRVLLNRKDAVSLLIFSLFGALTVQYTFLMTIEQSNAATATVLQFLSPTIIVAWFAIA
RKTRPSPLVLAAIATSLAGTFLLVTHGNPTTLSISPTALFWGIASAFAAAFYTTYPSTLI
ARYGTLPIVGWSMLLGGAMLLPFYAGQGNHFVVTGGLLLAFFYLVVIGTSLTFSLYLNGA
QKIGGAKAGILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVVLIALDSRRRVKTA