Protein Info for BWI76_RS27715 in Klebsiella michiganensis M5al

Annotation: PTS N-acetylmuramic acid transporter subunits IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 115 to 141 (27 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 304 to 329 (26 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 444 to 469 (26 residues), see Phobius details PF00367: PTS_EIIB" amino acids 11 to 43 (33 residues), 46.1 bits, see alignment (E = 2.5e-16) PF02378: PTS_EIIC" amino acids 122 to 404 (283 residues), 128.3 bits, see alignment E=3.4e-41

Best Hits

Swiss-Prot: 76% identical to PTYBC_PHOLL: PTS system N-acetylmuramic acid-specific EIIBC component (murP) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K11191, PTS system, N-acetylmuramic acid-specific IIB component [EC: 2.7.1.69] K11192, PTS system, N-acetylmuramic acid-specific IIC component (inferred from 94% identity to kva:Kvar_0056)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBL9 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BWI76_RS27715 PTS N-acetylmuramic acid transporter subunits IIBC (Klebsiella michiganensis M5al)
MAKINKEMIARILQHVGGAGNVAQAGNCMTRLRLTLRDESRADSAAIRQIEGVMGVIVSD
EQFQVVLGPGKAQTAAEMMNALLEDAPAETPSLADVAAEKKQALKSKQTSGIQKFLAKFA
TIFTPLIPGFIAVGLLLGFATLAEQIFVLENAHPNATMVALIGYMKVFSKGMFTFLSILI
GYNAQKAFGGSGVNGAIIAALFVLGYNPEATSGFYSGISTFFGHGIDPRGNIIGVLIASI
IGAWVERQVRRIMPANLDMILTSAVTLLIMGAITFTVIMPIGGWLFTGMSWLFLHLNGNP
FGSAVLAGLFLLAVMFGVHQGFVPVYFALVDAQGFNSLFPILAMAGAGQVGAALALFWRA
KHGSLLRTQIKGAIIPGFLGIGEPLIYGVTLPRMKPFITACLGGACGGFFLGLVAWMGLP
VGLNTVFGPSGLVALPLMTSNSGIYAGMAVYAAGLAVSYLCGFALTWLFGSKNVDLS