Protein Info for BWI76_RS27710 in Klebsiella michiganensis M5al

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 8 to 298 (291 residues), 417.5 bits, see alignment E=1.2e-129 PF22198: GKRP_SIS_2" amino acids 49 to 115 (67 residues), 39.3 bits, see alignment E=9.1e-14 PF22645: GKRP_SIS_N" amino acids 49 to 156 (108 residues), 73.8 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 94% identical to MURQ_KLEAE: N-acetylmuramic acid 6-phosphate etherase (murQ) from Klebsiella aerogenes

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 94% identity to kpe:KPK_0051)

MetaCyc: 57% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BC18 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BWI76_RS27710 N-acetylmuramic acid 6-phosphate etherase (Klebsiella michiganensis M5al)
MSIDLSKLLTERRNANSANIDTLSTEEMLTVINQEDQQVAHAITPYLAQIAQVVDKVAAA
LQAGGRLIYIGAGTSGRLGILDASECPPTFGTRPEQVVGIIAGGHKAILSAVENVEDNKA
QGAMDLQNINFSSRDVLVGLAASGRTPYVIGAMEYAYSQNAFVAIVSCNPHGEMAQLADV
AITPVVGPEVVTGSTRLKAGTAQKLVLNMISTGAMIRIGKVYSNLMVDVEATNAKLIERQ
VSIVMEATECDRATAQSALEACGRHCKTAIVMVLADLSAPDAQALLAKNNGYIRKALSHS