Protein Info for BWI76_RS27705 in Klebsiella michiganensis M5al

Annotation: Bcr/CflA family drug resistance efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 6 to 377 (372 residues), 284.8 bits, see alignment E=7.1e-89 PF07690: MFS_1" amino acids 14 to 353 (340 residues), 169.6 bits, see alignment E=1.9e-53 PF06779: MFS_4" amino acids 26 to 365 (340 residues), 27.3 bits, see alignment E=4.8e-10 PF00083: Sugar_tr" amino acids 26 to 181 (156 residues), 38.4 bits, see alignment E=1.5e-13 PF13347: MFS_2" amino acids 109 to 326 (218 residues), 30.6 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 85% identity to kva:Kvar_0058)

Predicted SEED Role

"Putative membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBW2 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BWI76_RS27705 Bcr/CflA family drug resistance efflux transporter (Klebsiella michiganensis M5al)
MPRISLSWVVVLGLLSAIGPLCTDFYLPALPEITQQLSATGTQTQLSLTAALIGLGLGQL
FFGPLSDRIGRKKPLALSLLLFIFSSAMCAITYDIHMLIAWRFLQGFAGAGGSVLSRSIA
RDRYQGTLLTQFFALLMTVNGIAPVLSPVLGGWIITAFDWRILFWAMAAIGVVLLLLSLT
VLHETLPEKSAASVAQRQDETPVLKNRRFMRYCLIQAFMMAGLFSYIGSSSFVIQSEYAM
SAMQFSLLFGLNGIGLIIAALIFSRLARRFSAESLLRGGQLLAVAFAAITLLFAWLPQPT
LALVGLFFTVSMMSGISTVAGSEAMNAIHARQSGTASALMGTLMFVFGGIAAPLAGLGGE
TMLKMSLAMTLCYLAALLIGLKKPRSVA