Protein Info for BWI76_RS27675 in Klebsiella michiganensis M5al

Annotation: EmrB/QacA family drug resistance transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 17 to 431 (415 residues), 269.7 bits, see alignment E=2.4e-84 PF07690: MFS_1" amino acids 21 to 413 (393 residues), 192.9 bits, see alignment E=1.2e-60 PF06609: TRI12" amino acids 34 to 426 (393 residues), 32.9 bits, see alignment E=4.1e-12 PF00083: Sugar_tr" amino acids 52 to 186 (135 residues), 46.4 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to eae:EAE_06740)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBK7 at UniProt or InterPro

Protein Sequence (498 amino acids)

>BWI76_RS27675 EmrB/QacA family drug resistance transporter (Klebsiella michiganensis M5al)
MTSEIASQPAVPSIRLLFSALLLVMLLSALDQTIVSTALPTIVGELGGLDKLSWVVTAYI
LSSTIAVPLYGKFGDLFGRKVVLQVAIVLFLAGSVLCGLAQNMTQLVLMRGLQGLGGGGL
MVISMAAVADVIPPANRGRYQGLFGGVFGLATVIGPLIGGFLVQHASWRWIFYINLPLGL
FALLVIGAVFHSSNKRSQHQIDWLGAIYLSMALLCIILFTSEGGSVRAWSDPQLWCILAF
GLVGIIGFIHEERLASEPIIPLSLFRNRSFLLCSLIGFVIGMALFGSVTFLPLYLQVVKE
ATPTEAGLQLIPLMGGLLLTSIISGRIISRTGKYRVFPIIGTLLGVVGMVLLTRITIHSA
MWQLYLFTGVLGAGLGLVMQVLVLAVQNAMPAQMYGVATSGVTLFRSIGGSIGVALFGAV
FTHVLQSNLLRLLPEGAQLPRALNPAAVQNLPAEIRLDYLDAFGSAIHAAFLMAACIMAV
AFALSWLLKEAPLKTGAR