Protein Info for BWI76_RS27650 in Klebsiella michiganensis M5al

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 230 to 255 (26 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 135 (129 residues), 48.6 bits, see alignment E=4.9e-17 amino acids 148 to 274 (127 residues), 56 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 92% identity to kpn:KPN_04029)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBK0 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BWI76_RS27650 EamA family transporter (Klebsiella michiganensis M5al)
MTRQRQADLLLIAATVIAACGWIFSREAIAGMPVFAFLGLRFFFAALLLLPFCRGLRVER
QHWPRMIISGLWFALNLCLWIYSVSTTPSLGEGAFIMSLSMLFVPLTAWVMMKARPARAY
WECLPIAVVGLGLLSLHMPIAFHPSQGWFLLTALVQSIWFCYTSKSAREVPLIPLTTVQL
GITGLVGLGISAAVESWSQPFTLPTFGWLLASIVIATSLRFGLQMKGQKYAAVASAAIIM
VLEPLLTVIAAALWYGEQLPLQKIIGGLLILVAQLWFRWRMLKPLR