Protein Info for BWI76_RS27645 in Klebsiella michiganensis M5al

Annotation: ADP-ribose pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF00293: NUDIX" amino acids 45 to 157 (113 residues), 74.4 bits, see alignment E=4.5e-25

Best Hits

KEGG orthology group: None (inferred from 89% identity to eae:EAE_06690)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.13

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BCA3 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BWI76_RS27645 ADP-ribose pyrophosphatase (Klebsiella michiganensis M5al)
MKKKLTSADMHDVEVLADTPWFSMRKVGIDMAPGDRRDFYSIHYPRPAVGIVAMQDDKVL
LIRHYRYLIDQVVWAIPSGGVDEGEDPREAALRELREETGWQAQRADEIIRYNPSYGSSD
QLFITWLAHDLTWVGMDEDQDEVMETGWFTLEEIGQLIARGEMPDGLSLVPLLHLMAQRR
TGLA