Protein Info for BWI76_RS27565 in Klebsiella michiganensis M5al

Annotation: sugar aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01116: F_bP_aldolase" amino acids 4 to 282 (279 residues), 258.7 bits, see alignment E=3.7e-81

Best Hits

Swiss-Prot: 35% identical to GATY_SHIBS: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: None (inferred from 81% identity to ecv:APECO1_2802)

MetaCyc: 37% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)" in subsystem D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 4.1.2.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBZ3 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS27565 sugar aldolase (Klebsiella michiganensis M5al)
MFADMKSMVIKAWRERYALLAINCMNLESARAAVRVAEKHRAPIILNLYQGHLSHFPATT
AAAVVRVLAEEASVPVTLSLDHGKDPIKIRQAFRAGFSGLMIDASAFALAENIRQTRAVA
ELAASVGLCVEGELGHLADAPRYDQASNADLMTQPQDVSPFIEQTGIDLLAVSVGTAHGM
YAPGVTPMLDFDRLAQIQRASSVPLALHGGSGTPFEQLQRCPEFGVAKINVGAAVFEAGK
AALLHTLCHDSTIELADALSVMEQASADAIVPYLRASGSINKA