Protein Info for BWI76_RS27560 in Klebsiella michiganensis M5al
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to GATY_KLEP7: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 91% identity to ecm:EcSMS35_3993)MetaCyc: 39% identical to L-glycero-L-galacto-octuluronate-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
RXN-21532
Predicted SEED Role
"Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)" in subsystem D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 4.1.2.40)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- superpathway of hexitol degradation (bacteria) (18/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- superpathway of anaerobic sucrose degradation (18/19 steps found)
- gluconeogenesis I (13/13 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- homolactic fermentation (12/12 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- galactitol degradation (5/5 steps found)
- glycolysis IV (8/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- sedoheptulose bisphosphate bypass (2/2 steps found)
- 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
- glycolysis VI (from fructose) (8/11 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- D-tagatose degradation (2/3 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- N-acetyl-D-galactosamine degradation (3/5 steps found)
- sucrose degradation V (sucrose α-glucosidase) (3/5 steps found)
- oxygenic photosynthesis (11/17 steps found)
- lactose degradation I (2/5 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.13, 4.1.2.40
Use Curated BLAST to search for 4.1.2.13 or 4.1.2.40
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285BBJ0 at UniProt or InterPro
Protein Sequence (286 amino acids)
>BWI76_RS27560 hypothetical protein (Klebsiella michiganensis M5al) MLVSMHELLKPTREHGFAIGAFNVADSCFIRAVVEEAEATNTPAIISIHPSEHDFVGDAF FSYVRDITQRSRVPFTLHLDHGASVEHVLRAIQCGFTSVMIDGSLLPYEENVALTREVVR LAHAVGVSVEGELGTIGQTGTSVEGGVSEVTYTDPAQAEDFVARTGVDTLAVAIGTAHGI YPKGMQPKLQMHILRDIAGRLSIPLVLHGGSANPDAEIAESVTLGVGKINISSDMKYAYF QKAREILAKETWWDPNVIYPEPINAAREVIRHKMKLFGSTGKASLY