Protein Info for BWI76_RS27545 in Klebsiella michiganensis M5al

Annotation: sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01418: HTH_6" amino acids 10 to 65 (56 residues), 40.1 bits, see alignment E=2.9e-14 PF01380: SIS" amino acids 102 to 204 (103 residues), 36.3 bits, see alignment E=4.5e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to kpe:KPK_0079)

Predicted SEED Role

"transcriptional regulator, RpiR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBI4 at UniProt or InterPro

Protein Sequence (243 amino acids)

>BWI76_RS27545 sugar isomerase (Klebsiella michiganensis M5al)
MDLENIFRDVKLSKTEMTVLRFIQNDPEQCVREGIRAVAEHCYSNPSSLVRLAKKLKFSG
WLELVYFIKFNITMPKLDVTNDIDYMSIQPAERIAPLLESLQHHRILIHGSGFSQLIAQY
IYNKFLVTGVNASLALWPDYEILEQKNAAKFDSIWIISKSGRSSSALNWVKALEGKEINL
VCFTGDYQSPLAQAADTAFIIHDPQKFDDDIYWSNPFFGYCILGFERLLKMWFMQAGLPG
GGA