Protein Info for BWI76_RS27540 in Klebsiella michiganensis M5al

Annotation: glycoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02056: Glyco_hydro_4" amino acids 2 to 177 (176 residues), 92 bits, see alignment E=3.5e-30 PF11975: Glyco_hydro_4C" amino acids 192 to 436 (245 residues), 144.8 bits, see alignment E=3.6e-46

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_06535)

Predicted SEED Role

"Maltose-6'-phosphate glucosidase (EC 3.2.1.122)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization (EC 3.2.1.122)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.122

Use Curated BLAST to search for 3.2.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BC83 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BWI76_RS27540 glycoside hydrolase (Klebsiella michiganensis M5al)
MKLTVLGGGGVRSAFLAKSLAYNAHRIGLTEVVFLDSSAENLAIFGEIARYVFNAIRPDI
HFSVTSDPVPALKNSHYVITTLRVGGDESRIRDERIALEHNTLGQETTGAGGFAMAMRSI
PAILNYCRLIEEHAAEDAILFNFTNPSGLVTEAIIKSGFKRRVYGICDAPSELIRELPAI
LGCDERDLGVECYGLNHFSWFTHFTVRGEDVTERLIASPDLYRKTAMQYFSPELVQLCDK
QLLNEYLYYYYYREVALKAIQNAPETRGEQIARINHDMREELRTVDVKANPEAAFTLWMK
HYLRRENSYMQNESQQEKFHTREPLTLKQFIEEPDTGGYAGVALDILEAVNSTATKRIVV
SMSNNGTLDFLRPDDVIEISCDLSKDGLKPVTPKHVPTAQKNMIASVKEYERLAVAAILQ
RDKSLAVRALMAHPLVGSYSLAKTLVEAYLDDKQFADWQ