Protein Info for BWI76_RS27535 in Klebsiella michiganensis M5al

Annotation: PTS transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 364 to 378 (15 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details PF02378: PTS_EIIC" amino acids 17 to 350 (334 residues), 187 bits, see alignment E=4.9e-59 TIGR00826: PTS system, glucose-like IIB component" amino acids 411 to 502 (92 residues), 72.3 bits, see alignment E=1.6e-24 PF00367: PTS_EIIB" amino acids 446 to 478 (33 residues), 51.3 bits, see alignment (E = 6.3e-18)

Best Hits

KEGG orthology group: None (inferred from 95% identity to eae:EAE_06530)

Predicted SEED Role

"PTS system, maltose and glucose-specific IIC component (EC 2.7.1.69) / PTS system, maltose and glucose-specific IIB component (EC 2.7.1.69)" in subsystem Maltose and Maltodextrin Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBR2 at UniProt or InterPro

Protein Sequence (519 amino acids)

>BWI76_RS27535 PTS transporter subunit IIBC (Klebsiella michiganensis M5al)
MSVIRQRILENMQKFSRAMIGAVLFLPVIGLILALSSVLTNPTLISETSFLHQLGQLLGD
TFWPLFGNLGLLFCVGISYGLAKDKKTEVALVSVMCFIMFLGANHSWLEHTHGLAEKING
EYYGTGQTQLLGFVVVDMGVFLGIILGCTIAWVHNKVSTIELPGALSMYGGAKLTLVAMT
PVVIFYAIAFTWFWPFMTHGIAALTGFMKNAGVAGVFVYGFFEKFLIPTGLHHFVWSPFQ
LTQIGGTLSVDGQVVSGTQAIFLAYMRHPDLTPVMNEALRFSQQGMTTIFGLAGASLAFY
HTAKPEKKMMAKAILLPAIITSMLTGITEPIEFTFLFVSPLLWVIHATLTAASQAICDIF
TVRPWGASGLIEFLIYNLPLPVSLTRWPGYVLIGIGQFAVYYVIFRTLVVKLNLKTPGRE
DDENVKLYSKADYRKKMGEPQSVTNEIINGLGGKENIISVDNCFTRLRVAIHNMDLVDDT
ILKSTGANGVVRNRNEVQVIYGVKVGQVRSRVDSWLAEN