Protein Info for BWI76_RS27495 in Klebsiella michiganensis M5al

Annotation: CDP-diacylglycerol diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00672: CDP-diacylglycerol diphosphatase" amino acids 1 to 250 (250 residues), 419.1 bits, see alignment E=3e-130 PF02611: CDH" amino acids 31 to 249 (219 residues), 298.4 bits, see alignment E=1.7e-93

Best Hits

Swiss-Prot: 90% identical to CDH_KLEP3: CDP-diacylglycerol pyrophosphatase (cdh) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01521, CDP-diacylglycerol pyrophosphatase [EC: 3.6.1.26] (inferred from 90% identity to kva:Kvar_0094)

MetaCyc: 72% identical to CDP-diacylglycerol diphosphatase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol diphosphatase. [EC: 3.6.1.26]

Predicted SEED Role

"CDP-diacylglycerol pyrophosphatase (EC 3.6.1.26)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.6.1.26)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBH2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BWI76_RS27495 CDP-diacylglycerol diphosphatase (Klebsiella michiganensis M5al)
MRRVRYLLLALLVAVVAAMAGGYYWLHSGNPDALRKIVLQQCVPNQQQRQNPAPCAEVNL
KGGYVLFKDRNGPLQYLLMPTYRINGTESPLLLNPLTPNFFWQAWQGREIMSQHRGSAVS
DDAVSLTINSRSGRTQNHFHIHISCLRPDVRTQLDKEAPAISSRWLPLPGGLLGHEYLAR
RVTETELAQRSPFLMLAEEVPEAREHMGRFALAMAKQSDGSLVLLATERNLLTLNRASAE
EIQDHSCAILASR