Protein Info for BWI76_RS27445 in Klebsiella michiganensis M5al

Annotation: fructose-bisphosphatase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR00330: fructose-1,6-bisphosphatase, class II" amino acids 1 to 335 (335 residues), 606.4 bits, see alignment E=6.9e-187 PF03320: FBPase_glpX" amino acids 3 to 322 (320 residues), 439.2 bits, see alignment E=3.3e-136

Best Hits

Swiss-Prot: 91% identical to GLPX_ECOL6: Fructose-1,6-bisphosphatase class 2 (glpX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_06460)

MetaCyc: 91% identical to fructose-1,6-bisphosphatase 2 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBG4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BWI76_RS27445 fructose-bisphosphatase class II (Klebsiella michiganensis M5al)
MKRELAIEFSRVTEAAALAGYKWLGRGDKNTADGAAVNAMRIMLNLINIDGTIVIGEGEI
DEAPMLYIGERVGTGHGDAVDIAVDPIEGTRMTAMGQANALAVMAVGDKGCFLNAPDMYM
EKLIVGPGAKGTIDMNLPLAENLHNIARALNKPLSELTVTILAKPRHDDVIVELQKLGVR
VFAIPDGDVAASILTCMPDSEVDVMYGIGGAPEGVVSAAVIRALDGDMNGRLLARHHVKG
DSEENRRIGENELERCKAMGIEAGKVLRLDDMARSDNVVFSATGITKGDLLDGITRKGNM
ATTETLLIRGKSRTIRRIQSIHYLDRKDPDIQLHIL