Protein Info for BWI76_RS27440 in Klebsiella michiganensis M5al

Annotation: DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 PF17191: RecG_wedge" amino acids 15 to 171 (157 residues), 72.1 bits, see alignment E=1.4e-23 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 28 to 664 (637 residues), 827.7 bits, see alignment E=3.8e-253 PF01336: tRNA_anti-codon" amino acids 63 to 135 (73 residues), 39.4 bits, see alignment E=1.7e-13 PF00270: DEAD" amino acids 273 to 436 (164 residues), 91.4 bits, see alignment E=2e-29 PF04851: ResIII" amino acids 293 to 430 (138 residues), 46.6 bits, see alignment E=1.3e-15 PF07517: SecA_DEAD" amino acids 296 to 363 (68 residues), 28.7 bits, see alignment E=2.8e-10 PF00271: Helicase_C" amino acids 478 to 587 (110 residues), 65.2 bits, see alignment E=2.2e-21 PF19833: RecG_dom3_C" amino acids 617 to 676 (60 residues), 41.7 bits, see alignment 3.3e-14

Best Hits

Swiss-Prot: 93% identical to RECG_ECO57: ATP-dependent DNA helicase RecG (recG) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to eae:EAE_06455)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BC63 at UniProt or InterPro

Protein Sequence (693 amino acids)

>BWI76_RS27440 DNA helicase RecG (Klebsiella michiganensis M5al)
MQGRLLDAVPLNSLTGVGAAQSSKLAKIGLHTVQDLLLHLPLRYEDRTHLYQIGELLPGV
YATVEGEVLNCNITFGGRRMMTCQISDGSGILTMRFFNFSAAMKNSLATGRRVLAYGEAK
RGKHGAEMIHPEYRVQGDMSTPDLQETLTPVYPTTEGIKQATLRKLTDQALELLETCAIA
ELLPPELAQGMMSLPDALRTLHRPPPTLQLSELESGKHPAQRRLILEELLAHNLSMLALR
AGAQRYHALALSANDTLKDKLLASLPFTPTGAQARVTAEIERDMALDVPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRSWFEPLGVEVGWLAGKQKGKAR
QAQQQAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGQQQGFH
PHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRSDIIDRVRNACT
HEGRQAYWVCTLIEESDLLEAQAAEATWEELKLALPELNIGLVHGRMKSAEKQAVMSAFK
QGELHLLVATTVIEVGVDVPNSSLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKS
PLSKTAQKRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQAMIPE
VQRIARHIHERYPQQAQALIERWMPETERYSNA