Protein Info for BWI76_RS27400 in Klebsiella michiganensis M5al

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 79 to 410 (332 residues), 236.5 bits, see alignment E=2.6e-74

Best Hits

KEGG orthology group: None (inferred from 88% identity to kpe:KPK_0103)

Predicted SEED Role

"FIG00731810: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBW1 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BWI76_RS27400 chloride channel protein (Klebsiella michiganensis M5al)
MTAAAGNKNSFTRLIAVVLTGILAGLSGMVLALILHAIQHLAFGYSPGQIVSAESFLQGV
TDSSWPRRISAIVAGGAIAGFGWWLLGRYGQKRVSIAAAVANPSVPMPAGTTTIHALLQI
VTVALGSPLGREVAPREMGALGAGMVARKLGLTADETRTLVACGAGAGLAAVYNVPLAGA
LFSLEVMLLSFSWEKTLAAIITSAIAAWTATLGLGDESQYHFASDILPHSFVWWAVITGP
ILGAGAWLFRKATSTARSHVRSNWQMPVFCLLAFSLLAVLSLYFPELPGNGKGPMQLALN
DELGFPGAAMLLALKMVVILAVLRGGAEGGLLTPGLAVGGMTSLLLCMLWQQLLPGGDCA
SFALVGAAAFLAASMQMPLTAVALVMEFTHMDHSYLAPTLLCAAGAFLTCRMLDKNYFF