Protein Info for BWI76_RS27320 in Klebsiella michiganensis M5al

Annotation: glucosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 201 to 216 (16 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 6 to 141 (136 residues), 73.8 bits, see alignment E=8.5e-25

Best Hits

Swiss-Prot: 85% identical to WAAE_KLEPN: Lipopolysaccharide core biosynthesis glycosyltransferase WaaE (waaE) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 88% identity to eae:EAE_06365)

Predicted SEED Role

"Putative two-domain glycosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBJ5 at UniProt or InterPro

Protein Sequence (258 amino acids)

>BWI76_RS27320 glucosyl transferase (Klebsiella michiganensis M5al)
MSPRLSVVMIAKNAADLLPDCLASVSWADEIVLLDSGSSDNTVELARSLGVQVHINRDWQ
GYGIQRQRAQDYATGDYVLMIDTDERVTPELAQSIRSVLAAPKAGAIYSIARRNYFLGRF
MRHSGWYPDRVMRLYERDRYRYNDNLVHESLDGQGAQVIELAGDLLHLTCRDFSGFQQKQ
LAYAAAWAQERHQRGKKTSLAAIFGHTLGAFVKTLLLRGGVLDGKQGWLLAVVNAQYTFN
KYTELWALSRGYSEKVSL