Protein Info for BWI76_RS27295 in Klebsiella michiganensis M5al

Annotation: putative lipopolysaccharide heptosyltransferase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR02201: putative lipopolysaccharide heptosyltransferase III" amino acids 15 to 358 (344 residues), 588.6 bits, see alignment E=1.8e-181 PF01075: Glyco_transf_9" amino acids 87 to 327 (241 residues), 180 bits, see alignment E=2.7e-57

Best Hits

Swiss-Prot: 41% identical to RFAQ_ECOLI: Lipopolysaccharide core heptosyltransferase RfaQ (rfaQ) from Escherichia coli (strain K12)

KEGG orthology group: K02849, heptosyltransferase III [EC: 2.4.-.-] (inferred from 87% identity to kva:Kvar_0132)

MetaCyc: 41% identical to lipopolysaccharide core heptosyltransferase 3 (Escherichia coli K-12 substr. MG1655)
RXN-22462 [EC: 2.4.99.25]; 2.4.99.25 [EC: 2.4.99.25]

Predicted SEED Role

"Lipopolysaccharide heptosyltransferase III (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.- or 2.4.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBD5 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BWI76_RS27295 putative lipopolysaccharide heptosyltransferase III (Klebsiella michiganensis M5al)
MTPETRTSGRVNPARILVIKLRHHGDMLLITPLIHALKQQYPAASVDVLLYEETRDMLAA
NTDITHIYGIDRRWKKQGAGHQLKMEWRLIRTLRQQRYDMVLNLADQWPSAIITKLTGAA
TRIGFDFPKRRHPAWRFCHTALASTEQHNQQHTVQQNLSILAPLGLAIDDAPAKMGYSDQ
DWRASRALLPEEFQDNYIVIQPTSRWFFKCWREARMSALINALSDAGYPVVLTSGPDARE
KQMIDTIMAGCPDARLHSLAGLLTLRQLASVIDHARLFIGVDSVPMHMAAALGTPLVALF
GPSKLTFWRPWQAQGEVIWAGDFGAIPDPDDIDTGTDERYLDLIPTDAVIAAAKKVLA