Protein Info for BWI76_RS27280 in Klebsiella michiganensis M5al

Annotation: polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 186 to 201 (16 residues), see Phobius details amino acids 207 to 223 (17 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 191 to 323 (133 residues), 88.4 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: None (inferred from 75% identity to kva:Kvar_0135)

Predicted SEED Role

"FIG00731458: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB91 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BWI76_RS27280 polymerase (Klebsiella michiganensis M5al)
MSTLKISSYARQGYTVFFTLFLFFSAVFCVSTRTNNLLHLSILLFLLSLLNHDNRQALAE
SIRQRWLVYILLVVFCVYYALSNIWGQTPQHIDSPLTHGAYLFFYLLVLTTLLGDPRTRH
LALLSVVAGITVLSIWTMAIDFTLVLKERLVSPGNPGPTNVIDLAGYCGIGILICAMLLK
EKGSHLLYVPMAIMLVMLFLTQSRGPIIALLAAFVCTLHLHVFTRRNVLIVAALALVLGA
LFFFTPTGDLLLARFEELGTQSGLRLSIWHHTLQEVASQPWLGRGFDYELNFTNYSGEHI
TTTHSVYLGALLKGGIIGLALLLAVIAGGLWQAWRNQQDGRYGLAIFIYALIFMASQGMF
IISNPRESWPLFWLPLGIALSGGLKAKR