Protein Info for BWI76_RS27240 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04748: Polysacc_deac_2" amino acids 28 to 238 (211 residues), 256.3 bits, see alignment E=7.6e-81

Best Hits

Swiss-Prot: 80% identical to YIBQ_ECOLI: Uncharacterized protein YibQ (yibQ) from Escherichia coli (strain K12)

KEGG orthology group: K09798, hypothetical protein (inferred from 89% identity to kpn:KPN_03959)

Predicted SEED Role

"Possible divergent polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BC24 at UniProt or InterPro

Protein Sequence (310 amino acids)

>BWI76_RS27240 hypothetical protein (Klebsiella michiganensis M5al)
MLQFRRIALAVTGTLVMASPVFAGKLSIVIDDFGYRPQTENQVLALPATISVAVLPNAPH
AREMAIKAHNLGHEVLIHLPMAPLSKQPLEKDTLRPDMNSSEIERIIREAYGKVPYAVGL
NNHMGSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDD
TQNEADIRYQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPPDITLVRPSSLLNE
PQVDTSTPNAAPPVKPPRNPFRGVKQCKSKRPPEPVNASRFFTILSESIAQSTLLQYYQL
KWQGWDQPTN