Protein Info for BWI76_RS27150 in Klebsiella michiganensis M5al

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 64 to 110 (47 residues), 44.9 bits, see alignment 1.6e-15 PF16576: HlyD_D23" amino acids 66 to 302 (237 residues), 34.6 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 83% identical to YIBH_ECO57: Inner membrane protein YibH (yibH) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to eae:EAE_06190)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBA5 at UniProt or InterPro

Protein Sequence (378 amino acids)

>BWI76_RS27150 secretion protein HlyD (Klebsiella michiganensis M5al)
MDLLIILTYVAIAWSIFKIFKIPVNKWTVPTAALGGVFIVSALILLMNYNHPYTFTAQKA
VISIPITPQVTGVVSSVTDKANQRVKKGEVLFTIDPARYQARVDRLQADLVTALHSINTL
KAQLSEAQANTTRVSAERDRLYKDYQRYLKGSQARVNPFSESDIDNARQNYLAQDAMVKG
SVAEQAQIQSQLDSIINGEQSQVVSLRAQLAEAKYNLDQTTVRAPSDGYITQVLIRPGTY
AASLPLRPVMVFIPQQKRLIVAQFRQNSLLRLEKGDDAEAVFNALPGQVFRGKLVSILPV
VPGGTYQAQGTLQALTVTPGTDGVLATIELEPDAAVDALPDGIYAQVAVYSDHFTHVSVM
RKVLLRMTSWMHYLYLDH