Protein Info for BWI76_RS27090 in Klebsiella michiganensis M5al

Annotation: DUF4862 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF16154: DUF4862" amino acids 9 to 297 (289 residues), 328.9 bits, see alignment E=1.6e-102

Best Hits

Swiss-Prot: 86% identical to Y3670_SALTY: Uncharacterized protein STM3670 (STM3670) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 86% identity to sty:STY4128)

Predicted SEED Role

"Putative chemotaxis protein, resembles cheA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBH0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>BWI76_RS27090 DUF4862 domain-containing protein (Klebsiella michiganensis M5al)
MNSNNTGYIIGAYPCAPSFHQKSEEEEMEFWRQLSDTPDIRGLEQPCLEHLHPLGDEWLL
RHTPGHWQIVVTAIMETMRRRGENGGFGLASSDETQRKACVEYYRHLQQKIAKINGNTAG
KVIALELHAAPLAGNANVAQATDAFARSLKEITRWDWSCELVLEHCDAMTGSAPRKGFLP
LENVLEAIADYDVSICINWARSAIEGRNTVLPLTHTQQVKRAGKLGALMFSGTTQTGEYG
EWQDLHAPFAPFCPQSLMTTEHARELFACAGTAPLQFSGIKLLEINASANVDHRIAILRD
GISALKQAQ