Protein Info for BWI76_RS27070 in Klebsiella michiganensis M5al

Annotation: 4Fe-4S ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF12800: Fer4_4" amino acids 10 to 22 (13 residues), 14 bits, see alignment (E = 2.6e-05) amino acids 88 to 102 (15 residues), 20.3 bits, see alignment (E = 2.3e-07) PF13247: Fer4_11" amino acids 55 to 140 (86 residues), 47.2 bits, see alignment E=9.4e-16 PF12838: Fer4_7" amino acids 58 to 103 (46 residues), 29.8 bits, see alignment E=3.1e-10 amino acids 88 to 138 (51 residues), 27.4 bits, see alignment E=1.7e-09 PF13237: Fer4_10" amino acids 82 to 135 (54 residues), 27.8 bits, see alignment E=9.4e-10 PF12797: Fer4_2" amino acids 83 to 101 (19 residues), 26.8 bits, see alignment (E = 1.5e-09) PF12837: Fer4_6" amino acids 84 to 103 (20 residues), 27.8 bits, see alignment (E = 7.9e-10) PF00037: Fer4" amino acids 84 to 104 (21 residues), 31.7 bits, see alignment (E = 4.2e-11) PF13187: Fer4_9" amino acids 88 to 138 (51 residues), 31.1 bits, see alignment E=8.5e-11 PF12798: Fer4_3" amino acids 89 to 103 (15 residues), 17.1 bits, see alignment (E = 3.7e-06)

Best Hits

Swiss-Prot: 62% identical to YSAA_ECOLI: Putative electron transport protein YsaA (ysaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_06165)

Predicted SEED Role

"Electron transport protein HydN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBN6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BWI76_RS27070 4Fe-4S ferredoxin (Klebsiella michiganensis M5al)
MNRFILADAEKCIGCRTCEVACVVSHQQDQDCSGVSAARFAPRIRVVKNDELSTATLCRQ
CEDAPCANVCPEGAIRRENSVWRVDQRRCIGCKSCMVACPYGAMTVMRVEEGVQALKCDL
CSHRDEGPACVAACPTQALRCMEPMELERIAAERRQRMALAT