Protein Info for BWI76_RS26955 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 233 to 258 (26 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 257 (240 residues), 149.8 bits, see alignment E=9.8e-48 amino acids 268 to 419 (152 residues), 57.3 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to eae:EAE_06055)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBK8 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BWI76_RS26955 MFS transporter (Klebsiella michiganensis M5al)
MNSSTNATKRWWYIMPIVFITYSLAYLDRANFSFASAAGITEDLGITKGISSLLGALFFL
GYFFFQIPGAIYAERRSVRKLIFICLILWGACASLTGMVHNIPALAAIRFILGVVEAAVM
PAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIQAFGWREMFIIEGVPAVI
WAFCWWVLVKDKPSQVNWLAESEKAALQEQLEREQQGIKPVRNYGEAFRSRNVVLLCMQY
FAWSIGVYGFVLWLPSIIRSGGENMGMVEVGWLSSVPYLAATIAMIVVSWASDKMQNRKL
FVWPLLLIAAFAFIGSWAVGANHFWVSYTLLVIAGAAMYAPYGPFFAIIPEMLPRNVAGG
AMALINSMGALGSFFGSWFVGYLNGTTGSPSASYIFMGVALFVSVWLTLIVKPANNQKLP
LGARHA