Protein Info for BWI76_RS26905 in Klebsiella michiganensis M5al

Annotation: oxalate/formate antiport family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details TIGR00890: oxalate/formate antiporter family transporter" amino acids 9 to 383 (375 residues), 442.5 bits, see alignment E=6.1e-137 PF07690: MFS_1" amino acids 26 to 232 (207 residues), 62.1 bits, see alignment E=2.3e-21 amino acids 241 to 384 (144 residues), 54.3 bits, see alignment E=5.4e-19

Best Hits

Swiss-Prot: 88% identical to YHJX_ECOLI: Uncharacterized MFS-type transporter YhjX (yhjX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_06010)

Predicted SEED Role

"Putative resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB63 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS26905 oxalate/formate antiport family MFS transporter (Klebsiella michiganensis M5al)
MNAANRQYTRWLTLLGTIITQFALGSVYTWSLFNSSLSAKLDEPVSQVAFSFGLLSLGLA
LSSSVAGKLQERFGVKRVTMASGVLLGLGFFLTAHSNSLMMLWLSAGLLVGLADGAGYLL
TLSNCVKWFPERKGLISAFSIGAYGLGSLGFKFIDSHLLATVGLEKTFIIWGAIVLVMIV
FGATLMTDAPNHTASASNGVVENDFTLAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDI
AQGMVHLDVATAANAVTVISIANLSGRLVLGILSDKMSRIRVITIGQVVSLIGMAALLFA
PLNATTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSLIA
SLFGGFYVTFCVIFALLILSLALSTTIRQPKSEIYHQAHA