Protein Info for BWI76_RS26870 in Klebsiella michiganensis M5al

Annotation: dipeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00005: ABC_tran" amino acids 24 to 182 (159 residues), 104.8 bits, see alignment E=8.9e-34 PF13304: AAA_21" amino acids 128 to 218 (91 residues), 29.2 bits, see alignment E=1.3e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 231 to 317 (87 residues), 92.4 bits, see alignment E=7.2e-31 PF08352: oligo_HPY" amino acids 233 to 297 (65 residues), 69.2 bits, see alignment E=4.8e-23

Best Hits

Swiss-Prot: 92% identical to DPPD_SHIFL: Dipeptide transport ATP-binding protein DppD (dppD) from Shigella flexneri

KEGG orthology group: K12371, dipeptide transport system ATP-binding protein (inferred from 94% identity to esa:ESA_04196)

MetaCyc: 92% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBC8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BWI76_RS26870 dipeptide ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MALLNVDKLSVHFGDEGTPFRAVDRVSYSVNQGEVVGIVGESGSGKSVSSLAIMGLIDYP
GRVMAEKLEFNGRDLKRISEKERRQLVGAEVAMIFQDPMTSLNPCYTVGYQIMEAIKVHQ
GGNKKTRIQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQRVMIAMAIACRPKLLIADEP
TTALDVTIQAQIIELLLELQQKENMALILITHDLALVAEAAHKIIVMYAGQVVETGDAKD
IFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPGKYDRPSGCLLNPRCPYATDKCRSE
EPELNLLNGGRQSKCHYPLDDAGRPGL