Protein Info for BWI76_RS26850 in Klebsiella michiganensis M5al

Annotation: cellulose synthase catalytic subunit (UDP-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 46 (17 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details amino acids 493 to 512 (20 residues), see Phobius details amino acids 524 to 545 (22 residues), see Phobius details amino acids 663 to 681 (19 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 2 to 675 (674 residues), 848.7 bits, see alignment E=1.5e-259 PF13641: Glyco_tranf_2_3" amino acids 127 to 354 (228 residues), 61.5 bits, see alignment E=3.2e-20 PF00535: Glycos_transf_2" amino acids 131 to 300 (170 residues), 71.1 bits, see alignment E=3.4e-23 PF13506: Glyco_transf_21" amino acids 194 to 379 (186 residues), 34 bits, see alignment E=4.6e-12 PF13632: Glyco_trans_2_3" amino acids 210 to 417 (208 residues), 64.5 bits, see alignment E=3.6e-21 PF03552: Cellulose_synt" amino acids 302 to 431 (130 residues), 28.3 bits, see alignment E=2.1e-10 PF07238: PilZ" amino acids 550 to 645 (96 residues), 32.1 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 94% identity to kpe:KPK_0212)

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.12

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBJ6 at UniProt or InterPro

Protein Sequence (703 amino acids)

>BWI76_RS26850 cellulose synthase catalytic subunit (UDP-forming) (Klebsiella michiganensis M5al)
MKKTLFWLLVLVLSPIAVLVVITPMDSQKQYIFGLLSIGILFLMGFSKNRSVSVIMVVTS
LLMSTRYMYFRLTQTLHFNSTIEAILGMGLFLAEVYIWVMLLLNYLQTVWPLKREIVPLP
DDMSKWPTVDIYIPSYNEPLEVVRDTVLAAQCIDYPKDKLKIYLLDDGKRNEFAVFAADV
GVGYITRNDNKHAKAGNLNHAMTLTHGELICVFDCDHVATRVFLQATVGGFLNDPMLALV
QTPHYFYSPDPFERNLSVGRNIPNEGMLFYGPIQQGNDNWNATFFCGSCAVIRRAALEQI
GGFAVETVTEDAHTALKFQRLGWKSAFLDIPLAAGLATERLVVHVIQRTRWARGMTQIFR
LDNPLLGRGLTFQQRLCYLSAMLYYQFALPRVVFVTAPLAYLLFNLNIIYSSASLIVSYA
LPHLFLAIYVGSRMNGRYRYSFWGEIYDIVLAFHLVLPTLVTMIFPKRGKFNVTDKGGLL
DVGYFDFTVVRPHLVVACLLGLGVIFGIVRAIGHDYFGSDPNVIALNVGWGIYSLIFLLA
AIAVARETRQVRKTIRIDVDIPVLIHYASGIVSRSHTADLSMGGCRVSAPDNRHLQDEIE
EIELILQSGAISIPVRQITADERFIRLQFDENIQLSRRRELVRVVLARADAWINPPRPQD
NPFRSFATILRCVFELFWLTWKTRRSQRRQPPAANPAQEDGSL