Protein Info for BWI76_RS26815 in Klebsiella michiganensis M5al

Annotation: small toxic polypeptide ldrD (Modular protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 41 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF13940: Ldr_toxin" amino acids 7 to 41 (35 residues), 71.7 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 71% identical to LDRD_ECOLI: Small toxic polypeptide LdrD (ldrD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 77% identity to eae:EAE_05955)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (41 amino acids)

>BWI76_RS26815 small toxic polypeptide ldrD (Modular protein) (Klebsiella michiganensis M5al)
MQQGGCMTLAQLGMVLWDDLAAPVIAGILVSMIVSWMDNRK