Protein Info for BWI76_RS26750 in Klebsiella michiganensis M5al

Annotation: PfkB domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00294: PfkB" amino acids 3 to 305 (303 residues), 241.5 bits, see alignment E=6.8e-76

Best Hits

Swiss-Prot: 88% identical to KDGK_ECOLW: 2-dehydro-3-deoxygluconokinase (kdgK) from Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W)

KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 91% identity to kpe:KPK_0230)

MetaCyc: 88% identical to 2-dehydro-3-deoxygluconokinase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxygluconokinase. [EC: 2.7.1.178, 2.7.1.45]

Predicted SEED Role

"2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.178 or 2.7.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB28 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS26750 PfkB domain-containing protein (Klebsiella michiganensis M5al)
MSKKIAVIGECMIELSEKGAAVNRGFGGDTLNTSVYIARQTDASALGVHYVTALGTDTFS
QQMLESWQSENVQTDLIQRMADRLPGLYYIETDDTGERTFYYWRNEAAAKFWLESEQSAA
ICEELATFDYLYLSGISLAILNPTSREKLLTLLRECRANGGKVIFDNNYRPRLWSSKEET
QQVYQQMLSCTDIAFLTLDDEDALWGEKPVAEVIARTHAAGVEEVVVKRGADSCLVAIAG
QPQLDVPAVKLPKEKVVDTTAAGDSFSAGYLAVRLTGGDAESAAKRGHLTASTVIQYRGA
IIPREAMPQSR