Protein Info for BWI76_RS26695 in Klebsiella michiganensis M5al

Annotation: iron-containing alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 243 to 262 (20 residues), see Phobius details amino acids 275 to 289 (15 residues), see Phobius details PF00465: Fe-ADH" amino acids 10 to 372 (363 residues), 295.3 bits, see alignment E=5.9e-92 PF13685: Fe-ADH_2" amino acids 34 to 106 (73 residues), 28.1 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to eae:EAE_05840)

Predicted SEED Role

"FIG00732123: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBG6 at UniProt or InterPro

Protein Sequence (382 amino acids)

>BWI76_RS26695 iron-containing alcohol dehydrogenase (Klebsiella michiganensis M5al)
MLTSFNVLTPGNIRFGRGLACSAAPWLAGRCAQILLVHGASLTRAEFLLSELHARQLHVT
TLSIAHEPSLQDIERGVRLAREKGVGAVVSLGGGAVIDAGKAIAALVPAQGPAIEYLEVV
GSGRLLEANPLPFVAIPTTAGTGAEVTKNAVINVPEQQRKVSLRDDRMLPDLAIIDPSLT
DNAPRAVTLASGLDAITQVIEPWLCARANPFTDALCREAIPRGIKALRTLMIKECPDSRD
EMAWVSLCGGLALANAGLGVIHGLAGPLGGLSNAAHGALCGSLLPFGLALNETQVSDEKI
RQRFADVRQWLAAGLDVDPNNAWESLREWSQRAGLGNLRELGVPREALEPAALAASSSSS
MKANPVMLTSEQLLEMLEAAWE