Protein Info for BWI76_RS26680 in Klebsiella michiganensis M5al

Annotation: 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04378: RsmJ
  • amino acids 33 to 278 (246 residues), 397.3 bits, E=1.1e-123

Best Hits

Swiss-Prot: 90% identical to RLMJ_ECOLI: Ribosomal RNA large subunit methyltransferase J (rlmJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_05805)

MetaCyc: 90% identical to 23S rRNA m6A2030 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6998 [EC: 2.1.1.266]

Predicted SEED Role

"Protein involved in catabolism of external DNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.266

Sequence Analysis Tools

See A0A285BBB0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BWI76_RS26680 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ (Klebsiella michiganensis M5al)
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAGAGRYQLSSEHAERTGE
YLEGIARIWQQDDLPAELEPYVSVVQHFNRSGQLRYYPGSPLIARQLLREQDSLQMTELH
PSDFPLLRAEFQKDDRARVEKTDGYQQLKSKLPPVSRRGLVLIDPPYEIKSDYQAVVTGI
HEGYKRFATGTYALWYPVVLRAQIKRMIKELEATGIRKILQIELAVRPDSDQRGMTASGM
IVINPPWKLEQQMNNVLPWLHKKLVPTGIGHATVSWIVPE