Protein Info for BWI76_RS26650 in Klebsiella michiganensis M5al

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 PF04023: FeoA" amino acids 16 to 71 (56 residues), 44.5 bits, see alignment E=6.8e-16

Best Hits

Swiss-Prot: 92% identical to FEOA_ECO57: Fe(2+) transport protein A (feoA) from Escherichia coli O157:H7

KEGG orthology group: K04758, ferrous iron transport protein A (inferred from 97% identity to kpn:KPN_03778)

Predicted SEED Role

"Ferrous iron transport protein A" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB09 at UniProt or InterPro

Protein Sequence (75 amino acids)

>BWI76_RS26650 iron transporter (Klebsiella michiganensis M5al)
MQFTPDSAWKITGFSRDISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVL
RKKDLALIELEAVAQ