Protein Info for BWI76_RS26645 in Klebsiella michiganensis M5al

Annotation: ferrous iron transporter B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 transmembrane" amino acids 102 to 122 (21 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 337 to 364 (28 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details amino acids 511 to 532 (22 residues), see Phobius details amino acids 664 to 685 (22 residues), see Phobius details amino acids 692 to 711 (20 residues), see Phobius details amino acids 723 to 742 (20 residues), see Phobius details PF01926: MMR_HSR1" amino acids 6 to 120 (115 residues), 71.6 bits, see alignment E=1.8e-23 PF02421: FeoB_N" amino acids 6 to 163 (158 residues), 215.7 bits, see alignment E=7.2e-68 TIGR00437: ferrous iron transport protein B" amino acids 10 to 687 (678 residues), 806.6 bits, see alignment E=7.6e-247 PF17910: FeoB_Cyto" amino acids 177 to 259 (83 residues), 37 bits, see alignment E=1.1e-12 PF07670: Gate" amino acids 351 to 445 (95 residues), 80.1 bits, see alignment E=4.8e-26 amino acids 512 to 687 (176 residues), 67.1 bits, see alignment E=5.2e-22 PF07664: FeoB_C" amino acids 455 to 507 (53 residues), 78.1 bits, see alignment 1e-25

Best Hits

Swiss-Prot: 89% identical to FEOB_SALTY: Fe(2+) transporter FeoB (feoB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_05305)

MetaCyc: 88% identical to Fe2+ transporter FeoB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-424

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBF7 at UniProt or InterPro

Protein Sequence (772 amino acids)

>BWI76_RS26645 ferrous iron transporter B (Klebsiella michiganensis M5al)
MKKLTLGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGGFNTTDHQVTLVDLPGT
YSLTTISSQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALN
MLDIAEKQNIRIDVDALAARLGCPVIPLVSTRGRGIEALKMAIDRHQQNQDIELVHYPRP
LLREADKLAEMMATDIPPRQRRWLGLQMLEGDIYSRAFAGDAAHKLDVALAHLSEELDDP
ALHIADARYQSIAAICDAVSNTLTAEPSRFTAAMDKVILNRFLGLPVFLFVMYLMFLLAI
NIGGALQPIFDAGSVAIFIHGIQWIGYTLHFPDWLTVFLAQGIGGGINTVLPLVPQIGMM
YLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLIVGFGCNVPSVMGARTLDAPRER
LMTIMMAPFMSCGARLAIFAVFAAAFFGQNGALAVFSLYVLGIVMAIATGLMLKHTIMRG
EASPFVMELPVYHVPHVKSLLIQTWQRLKGFVLRAGKVIVIVSIFLSALNSFSLNGKIVD
NINDSALASVSRVITPVFKPIGVHEDNWQATVGLFTGAMAKEVVVGTLNTLYTAEDIQNE
AFNPQAFSLGDELLAAVDETWQSLKDTFSLSVLANPIEASKGDGEMATGAMGVMGSKFGS
AAAAYSYLIFVLLYIPCISVMGAIARESSRGWMMFSVLWGLNIAYSLSTLYYQTVSFSQH
PRYSLVCILAVVLFNIVVFGLLRRARSRVDVSLLATRKTPSSCCQSPAGDCH