Protein Info for BWI76_RS26585 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 382 to 408 (27 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 9 to 483 (475 residues), 608 bits, see alignment E=7.2e-187 PF07690: MFS_1" amino acids 27 to 431 (405 residues), 55.2 bits, see alignment E=5.7e-19 PF00854: PTR2" amino acids 82 to 443 (362 residues), 322.3 bits, see alignment E=4.4e-100

Best Hits

Swiss-Prot: 94% identical to DTPB_SALTY: Dipeptide and tripeptide permease B (dtpB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 94% identity to kpe:KPK_0246)

MetaCyc: 88% identical to dipeptide/tripeptide:H+ symporter DtpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease DtpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBD8 at UniProt or InterPro

Protein Sequence (490 amino acids)

>BWI76_RS26585 MFS transporter (Klebsiella michiganensis M5al)
MNSTAPTGLLQQPRPFFMIFFVELWERFGYYGVQGILAVFFVKQLGFSQEQAFITFGAFA
ALVYGLISIGGYVGDHLLGTKRTLVLGAIVLAAGYFMTGLSLHQPNLIFIALGTIAVGNG
LFKANPASLLSKCYPPKDARLDGAFTLFYMSINIGSLLSLSLAPVIADKFGYAVTYNLCG
AGLIVALLVYFACRGMVKDIGSEPDRRPLSLRNLLYVLAGTVVMIFVCAWLMHNVKIANL
VLIILSLVVTIFFFREAFKLDKTGRNKMFVAFILMLEAVLFYILYAQMPTSLNFFAINNV
HHEILGFAINPVSFQALNPFWVVVASPILAAIYTRLGNKGKDLTMPMKFTLGMFLCALGF
LTAAAAGMWFADAQGLTSPWFIVLVYLFQSLGELLISALGLAMVAALVPQHLMGFILGMW
FLTQAAAFLLGGYVATFTAVPDTITDPLQTLPIYTDVFSKIGLVTLGVTVVMAIMVPWLN
RMINTPDTKQ