Protein Info for BWI76_RS26575 in Klebsiella michiganensis M5al

Annotation: universal stress protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details PF10625: UspB" amino acids 1 to 107 (107 residues), 180.1 bits, see alignment E=4.8e-58

Best Hits

Swiss-Prot: 97% identical to USPB_KLEP3: Universal stress protein B (uspB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06144, universal stress protein B (inferred from 93% identity to eco:b3494)

Predicted SEED Role

"Universal stress protein B" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAZ0 at UniProt or InterPro

Protein Sequence (111 amino acids)

>BWI76_RS26575 universal stress protein B (Klebsiella michiganensis M5al)
MISTIALFWALCIVCVVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM
RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSMIALAIWH