Protein Info for BWI76_RS26560 in Klebsiella michiganensis M5al

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF06506: PrpR_N" amino acids 26 to 190 (165 residues), 120.1 bits, see alignment E=2.4e-38 PF00158: Sigma54_activat" amino acids 316 to 483 (168 residues), 210 bits, see alignment E=5.9e-66 PF14532: Sigma54_activ_2" amino acids 317 to 488 (172 residues), 69.5 bits, see alignment E=1.1e-22 PF07728: AAA_5" amino acids 342 to 459 (118 residues), 28.9 bits, see alignment E=3.1e-10 PF02954: HTH_8" amino acids 584 to 622 (39 residues), 48.9 bits, see alignment 1.3e-16

Best Hits

KEGG orthology group: None (inferred from 76% identity to cro:ROD_43091)

Predicted SEED Role

"putative sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAU7 at UniProt or InterPro

Protein Sequence (627 amino acids)

>BWI76_RS26560 sigma-54-dependent Fis family transcriptional regulator (Klebsiella michiganensis M5al)
MNNNEIVIFSVSRTITQRIMNVLIERKLDIPVFEFRYSDVLDKAHEMIQSGTKIIISRGG
TAALLRSNITIPVIEIAHDFHGVYRILQEANSKSQKIAAVGFPQFCSALRHYQNMTNEEF
KICQVYNHHDIENVIKNLSENNYHTVIGGLTVAEMAQKYHLNAIMGDTDNISIEQAINEA
HSLLKYINREHSKLIMSHSALNQAREGIMCIDQLGEIININATGVALFQCQAGDKIFKKE
AFKEIYASIINELDIKEQAIDINGVTIHISVRHFSNRKISYAVITGLSQESTLWQNSVNK
KSKLRGFSTTWSFDDIIGQSPAILDVIKKAKLCARHELPIHILGDTGTGKELFAQSIHNH
SARSHSPFIAINCAAIPEGILESELFGYADGAFTSARKGGKPGVFEMAMNGTVFIDEISE
APLSVQVKLLRVLQEKQFSRLGGDTLITADFRLITASNKDLRPLVASGEFRQDLYYRINI
LELSLPALCQRPGDIMPLIQHLLHQQGKQITFTPDAVDFLHGYRWPGNIRELQAVIYRLI
VLVDIDRVSKEILLQVSQISPDDDNEGSHLPATGVTSDETDLLKKQEKRLITHVIEKTDG
DRTKASVMLGISPTTLWRKLKQHNISG