Protein Info for BWI76_RS26550 in Klebsiella michiganensis M5al

Annotation: transporter, divalent anion:Na+ symporter (DASS) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 27 to 45 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details amino acids 284 to 284 (1 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 357 to 386 (30 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 3 to 463 (461 residues), 411.9 bits, see alignment E=4.4e-127 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 20 to 459 (440 residues), 359.9 bits, see alignment E=8.9e-112 PF03600: CitMHS" amino acids 51 to 405 (355 residues), 70.1 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 37% identical to YBHI_ECOLI: Inner membrane protein YbhI (ybhI) from Escherichia coli (strain K12)

KEGG orthology group: K03319, divalent anion:Na+ symporter, DASS family (inferred from 98% identity to kpe:KPK_0253)

Predicted SEED Role

"anion transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAZ3 at UniProt or InterPro

Protein Sequence (464 amino acids)

>BWI76_RS26550 transporter, divalent anion:Na+ symporter (DASS) family protein (Klebsiella michiganensis M5al)
MLYLKLLPIIFFPVLFWIIPHPEGVAAPTWHMVGIYLAMLCGLVLRPFTDAVIMLIILGF
ASLVLDPAPLFAGFGSPMVWFIISAFIICKAFVITGLGKRIAYLLLKRYGKNTLTLGYLM
MVTDTVLAPATGSNMSRSGGITYPIFRNIAEALGSKPDDGSRKIGAYLTILMYVVSMGTS
SLFLTGMATNSITVSLANEIMKVNLEWMTWFKAAVVPAGLVLLLAPWILYKIYAPELKVI
DNVNEIAEKGLCELGPVKREEKLLIVFFILGVLGWMTGSITGIAFIPVGLAFLACLLLFG
VLSWNDVVSEKSAWQTFVWYGAFYGCAVALSKGGFYVFLVDVIKNYLDLSHLNEISAIAV
LVFISLAVRYFFVSNSAFVVSFYPVLFTLGMTTQAHPMYVALSLAFSAGYGALLTHYGNG
AGVFTFSSGYVPQKTFWMLGTIMVVVNVLIFFLIGIPYWKFIGI