Protein Info for BWI76_RS26530 in Klebsiella michiganensis M5al

Annotation: MgtE integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 225 (28 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details PF00571: CBS" amino acids 22 to 77 (56 residues), 20.9 bits, see alignment E=3.7e-08 amino acids 88 to 139 (52 residues), 20 bits, see alignment 7.3e-08 PF01769: MgtE" amino acids 206 to 328 (123 residues), 114.7 bits, see alignment E=3.4e-37

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 91% identity to kpu:KP1_5196)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB82 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BWI76_RS26530 MgtE integral membrane protein (Klebsiella michiganensis M5al)
MSSIQLCAARHATSAFDGDAIAQYMRTDFITLPEHLSVHEARELFVSQLASDEIPGQVFV
VAGKKLRGSLSIKKLLQESDTAQSIRYLMDSCLFRVRPDDPRPQVVAELGERGLDLVPVV
EKGELVGCLMEKEIAHLLEDDVTEDAQRQGATLPLEKPYLETSPWALWKKRSVWLLLLFV
AEAYTSSVLQHFEEALESAIALAFFIPLLIGTGGNSGTQITSTLVRSMALGEVRLRDMGR
VIRKEVSTSLLIAIMLGLAGCLRAWMMGIGMEITLIVSLTLVCITLWSAVVSSVIPLTLK
RLGIDPAVVSAPFIATLIDGTGLIIYFKIAQYFLGLN