Protein Info for BWI76_RS26505 in Klebsiella michiganensis M5al

Annotation: nickel ABC transporter permease subunit NikB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 134 to 161 (28 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 105 (105 residues), 32.4 bits, see alignment E=9.4e-12 TIGR02789: nickel ABC transporter, permease subunit NikB" amino acids 1 to 313 (313 residues), 536.6 bits, see alignment E=1.1e-165 PF00528: BPD_transp_1" amino acids 117 to 308 (192 residues), 156.6 bits, see alignment E=6e-50

Best Hits

Swiss-Prot: 92% identical to NIKB_ECOLI: Nickel transport system permease protein NikB (nikB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 93% identity to cko:CKO_04927)

MetaCyc: 92% identical to nickel ABC transporter membrane subunit NikB (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport system permease protein NikB (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB29 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BWI76_RS26505 nickel ABC transporter permease subunit NikB (Klebsiella michiganensis M5al)
MLRYALRRVALLIPMIFAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMVASTRAMLGL
DQPLIIQYGSWLWRALQLDFGVSFATQRPVLDDMLSFLPATLQLAGAALVLILLTSVPLG
IWAARHRDRLPDFIVRIIAFLGVSMPNFWLAFLLVMFFSVYLQWLPAMGYGGWRHIILPA
VSIAFMSLAINARLLRASMLEVAGQRHVTWARLRGLNAKQTERRHILRNASLPMITAVGM
HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVIVFVVCNLMVDLLNA
ALDPRIRRHEGARS