Protein Info for BWI76_RS26465 in Klebsiella michiganensis M5al

Annotation: 4-amino-4-deoxy-L-arabinose lipid A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 164 to 195 (32 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details PF02366: PMT" amino acids 4 to 237 (234 residues), 176.8 bits, see alignment E=6e-56 PF13231: PMT_2" amino acids 61 to 222 (162 residues), 45.4 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 90% identical to ARNT_KLEP7: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 90% identity to kpu:KP1_5180)

MetaCyc: 63% identical to lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-2001 [EC: 2.4.2.43]

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.2.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB54 at UniProt or InterPro

Protein Sequence (551 amino acids)

>BWI76_RS26465 4-amino-4-deoxy-L-arabinose lipid A transferase (Klebsiella michiganensis M5al)
MKSIRYGASLVALFVLYYILPLNFRLLWQPDETRYAEISREMLATGDWVVPHFLGLRYFE
KPIAGYWINSIGQWLFGHNNFAVRFGVVFSITVTALLVAWLAWRLFRDKRVAILSPVIFL
TALLVYGIGTYAVLDPMITMWMALAMCSFWGATQAQSHGGKIFGYVLLGVACGMGVMTKG
FLALAVPVVGVLPWVIARKRWREVLTYGWLAVGVCALVVLPWGLAIAKREPDFWRYFFWV
EHIQRFAEKDAQHKAPFWYYIPFLIAGSLPWLALLPGALKRGWTERDEARGALYLLGWVA
MPLLFFSIAKGKLPTYILPCFAPLSILMARYALDAAKAGVKALKINGAINLAFGLIGLVA
VLVVSPWGFMHKPVWSHIELYKCLLAALIFGWWALMGWLAMKDNGRRWTLAACCPLGLAL
LVGFAIPDRVIDSKQPQFLVDIVSESLTPSRYVLTNNVGIAGGLSWELKRSDIILFDKQG
ELKYGLSWPDAQHQFVDQAHFADWLATHRQQGPVSLVLLMDKGESMADLALPKPDSFYEL
GRVVFIQYLPQ