Protein Info for BWI76_RS26460 in Klebsiella michiganensis M5al

Annotation: 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 108 (104 residues), 45.8 bits, see alignment E=7.4e-16

Best Hits

Swiss-Prot: 89% identical to ARNE_KLEP3: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K12962, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE (inferred from 89% identity to kpe:KPK_0271)

MetaCyc: 66% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnE subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276

Predicted SEED Role

"Polymyxin resistance protein PmrL, sucrose-6 phosphate hydrolase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAS9 at UniProt or InterPro

Protein Sequence (112 amino acids)

>BWI76_RS26460 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (Klebsiella michiganensis M5al)
MSVWICLVFASLLSCAGQLCQKQATRPSKSGRRGRHILGWLGLALLALGCSMLLWLSVLQ
SIPVSIAYPMLSLNFVWVTLAAWGIWREPVARRHWLGVGLIVVGIVILGSRI