Protein Info for BWI76_RS26460 in Klebsiella michiganensis M5al

Annotation: 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00892: EamA
  • amino acids 7 to 108 (102 residues), 47.5 bits, E=2.1e-16

Best Hits

Swiss-Prot: 89% identical to ARNE_KLEP3: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K12962, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE (inferred from 89% identity to kpe:KPK_0271)

MetaCyc: 66% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnE subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276

Predicted SEED Role

"Polymyxin resistance protein PmrL, sucrose-6 phosphate hydrolase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

See A0A285BAS9 at UniProt or InterPro

Protein Sequence (112 amino acids)

>BWI76_RS26460 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (Klebsiella michiganensis M5al)
MSVWICLVFASLLSCAGQLCQKQATRPSKSGRRGRHILGWLGLALLALGCSMLLWLSVLQ
SIPVSIAYPMLSLNFVWVTLAAWGIWREPVARRHWLGVGLIVVGIVILGSRI