Protein Info for BWI76_RS26450 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 204 to 233 (30 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 328 (315 residues), 279 bits, see alignment E=2.6e-87

Best Hits

Swiss-Prot: 90% identical to YHHT_ECO57: Putative transport protein YhhT (yhhT) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to cko:CKO_04904)

MetaCyc: 47% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative PerM family permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAX4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BWI76_RS26450 hypothetical protein (Klebsiella michiganensis M5al)
MTTPQPDKTGMHILLKLASLVVILAGIHAAADIIVQLLLALFFAIVLNPLVTWFIRRGVR
RPAAITIVVVVMLIVLTALIGVLAASVNEFVAMLPKYNKELTAKVLRLQEALPFLHIHMS
PERMLQRIDSDKLMTFTTTLMTGLSGAMASVVLLVMTVVFMLFEVRHVPYKLRFALNNPQ
IHIAGLHRALKGVSHYLALKTLLSLWTGVIVWLGLMLMGVQFALMWGVLAFLLNYVPNIG
SVISAVPPMVQALLFNGYYECLMVGALFLVVHMIIGNILEPRMMGHRLGMSTLVVFLSLL
VWGWLLGPVGMLLSVPLTSVCKIWMETTKGGSKLAILLGPGRPKSRLPG