Protein Info for BWI76_RS26445 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 142 (31 residues), see Phobius details amino acids 152 to 199 (48 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 366 (25 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 352 (328 residues), 86.7 bits, see alignment E=7.8e-29 amino acids 254 to 400 (147 residues), 48.7 bits, see alignment E=2.7e-17

Best Hits

Swiss-Prot: 87% identical to YHHS_ECOL6: Uncharacterized MFS-type transporter YhhS (yhhS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 91% identity to kpe:KPK_0274)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBB7 at UniProt or InterPro

Protein Sequence (406 amino acids)

>BWI76_RS26445 MFS transporter (Klebsiella michiganensis M5al)
MPETVAEPALNGLRLNLRIVSVVMFNFASYLTIGLPLAVLPGYVHDVMGFSAFWAGLVIS
LQYFATLLSRPHAGRYADLLGPKKIVVFGLCGCFLSGLGYLLAALFGDLPAVSLALLCLG
RIILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMGAPLGVLCYSLIGLH
GLALTIMAVALVAVLCALPRAAVKAGRGKAMSFRAVLGRVWLYGMALALASAGFGVIATF
ITLFYDAKGWDGAAFALTLFSCAFVGTRLLFPNGINRLGGLNVAMLCFVVEIIGLLLVGL
AETPLMAKIGTFFAGAGFSLVFPALGVVAVKAVPQQNQGSALATYTVFMDLSLGITGPLA
GLLMAWAGISSIYLATAGLVAVALLLGWRLKKRPPVGEPEAAASGQ