Protein Info for BWI76_RS26400 in Klebsiella michiganensis M5al

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02881: SRP54_N" amino acids 217 to 282 (66 residues), 54.4 bits, see alignment E=1.8e-18 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 229 to 500 (272 residues), 385 bits, see alignment E=9.6e-120 PF06414: Zeta_toxin" amino acids 292 to 406 (115 residues), 29.5 bits, see alignment E=7.6e-11 PF00448: SRP54" amino acids 300 to 500 (201 residues), 264.8 bits, see alignment E=6.6e-83

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_05535)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBA7 at UniProt or InterPro

Protein Sequence (504 amino acids)

>BWI76_RS26400 signal recognition particle-docking protein FtsY (Klebsiella michiganensis M5al)
MAKDKKRGFFSWLGFGQKEQAQESETEQKVEAQQEVAEPSAESEAPAAAPQTVDAPATEK
PDAEAFAAEVVEVTEQVVESEQPQAVVESPVVEEVVEQPAVEEIVAEPLVEEVIAEPVAA
EAVAEQTPEAVIAEPEAVIEEAVVEDAEAGEPLADAQADISDEELEAQALAAADAAENAV
EVVPDETVVTPLEQEKPTKEGFFARLKRSLVKTKQNLGSGFISLFRGKKIDDDLFEELEE
QLLIADVGVETTRKIITNLTNDASRKQLRDAEALYGLLKEEMGDILAKVDEPLNVEGKTP
FVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIA
QHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPH
EVMLTIDASTGQNAISQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGV
GERIEDLRPFNAGDFIEALFARED